PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P14070_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 293aa    MW: 33859.8 Da    PI: 10.6394
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P14070_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.7e-19140194357
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                            k++++++eq++ Le  F+ +r++   +++++A++lgL+ +qV vWFqNrRa++k+
  GSMUA_Achr4P14070_001 140 KKRRLSDEQVRFLEMSFRDERKLASGRKAHIAAELGLDGKQVAVWFQNRRARHKN 194
                            45689************************************************95 PP

2HD-ZIP_I/II107.78.8e-35140230292
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kkrrls+eqv++LE+sF+ e+kL + rK+++a eLgl+ +qvavWFqnrRAR+k+kqlE+ y +Lk +++a++ e+++Le+ev +L+e
  GSMUA_Achr4P14070_001 140 KKRRLSDEQVRFLEMSFRDERKLASGRKAHIAAELGLDGKQVAVWFQNRRARHKNKQLEEAYLKLKLEHEAVVVEKCHLENEVLRLKE 227
                            9**************************************************************************************9 PP

            HD-ZIP_I/II  90 elk 92 
                            +l 
  GSMUA_Achr4P14070_001 228 KLL 230
                            985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.05135195IPR001356Homeobox domain
SMARTSM003892.3E-17138199IPR001356Homeobox domain
SuperFamilySSF466897.7E-16139200IPR009057Homeodomain-like
CDDcd000864.46E-14140196No hitNo description
PfamPF000462.5E-16140194IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-17140194IPR009057Homeodomain-like
PRINTSPR000313.4E-5166175IPR000047Helix-turn-helix motif
PROSITE patternPS000270170193IPR017970Homeobox, conserved site
PRINTSPR000313.4E-5175191IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MATVNSINLA SPPRTPLPIF SHGIHAIVAN GRRAFESTTT HLPINKSRNF NRCMHRRVFL  60
SLPTTPLVLQ EIRVSLFLRD SRQHERSFTL SIPTLVSNAS RLVHHMTFPF LAKANVIFSV  120
GDTRTRRRRL RRRKVKGDAK KRRLSDEQVR FLEMSFRDER KLASGRKAHI AAELGLDGKQ  180
VAVWFQNRRA RHKNKQLEEA YLKLKLEHEA VVVEKCHLEN EVLRLKEKLL EAEEEIRKLS  240
WSVNGGNLGS SFSAVSQQPL HGEFGTEAEA ELTYMDEYDL YNYTMEWTNP YGI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126142RRRLRRRKVKGDAKKRR
2130143RRRKVKGDAKKRRL
3187195RRARHKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396732.11e-137PREDICTED: homeobox-leucine zipper protein HOX12-like
SwissprotQ7XI856e-47HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLM0SNS20.0M0SNS2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P14070_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-29homeobox protein 40